PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676759572
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 72aa    MW: 7685.67 Da    PI: 9.8978
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676759572genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer64.61.9e-203069342
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalk 42
                 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt+aal+
    676759572 30 GVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGTVAALT 69
                 79*********************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-18169IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-163169IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.0E-163269IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152317.4723372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
MRKRQVVLRR ASPEEPSRSS STASSLTVRG VRYGECQKNH AAAVGGYAVD GCREFMASNG  60
EEGTVAALTV LK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9533303e-83EU953330.1 Zea mays clone 1399539 zinc finger homeodomain protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395327.12e-43hypothetical protein EUTSA_v10005183mg
SwissprotQ9LJW53e-31MIF2_ARATH; Mini zinc finger protein 2
TrEMBLV4KYT92e-43V4KYT9_EUTSA; Uncharacterized protein
STRINGBra025362.1-P2e-42(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.17e-26mini zinc finger 2